Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [278213] (2 PDB entries) |
Domain d4yp6b_: 4yp6 B: [278214] automated match to d1m8ga_ complexed with nap |
PDB Entry: 4yp6 (more details), 1.9 Å
SCOPe Domain Sequences for d4yp6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yp6b_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanothermobacter thermautotrophicus [TaxId: 187420]} tmrgllvgkmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltka lsengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtap plfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak
Timeline for d4yp6b_: