SCOPe 2.06: Domain d1huha_: 1huh A:

Lineage for d1huha_ (1huh A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d1huha_: 1huh A: [27820]
   complexed with iod, zn

Details for d1huha_

PDB Entry: 1huh, 2.2 Å

PDB Description: differences in anionic inhibition of human carbonic anhydrase i revealed from the structures of iodide and gold cyanide inhibitor complexes

PDB Compounds: (A:) carbonic anhydrase I

SCOPe Domain Sequences for d1huha_:

Sequence; same for both SEQRES and ATOM records:

>d1huha_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

Timeline for d1huha_:

• d1huha_ first appeared (with stable ids) in SCOP 1.55, called d1huh__
  
• d1huha_ appears in SCOPe 2.05
  
• d1huha_ appears in SCOPe 2.07
  
• d1huha_ appears in the current release, SCOPe 2.08