SCOPe 2.05: Domain d4uv7l1: 4uv7 L:1-112

Lineage for d4uv7l1 (4uv7 L:1-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4uv7l1: 4uv7 L:1-112 [278189]
   automated match to d3aazb1
   complexed with nag

Details for d4uv7l1

PDB Entry: 4uv7, 2.1 Å

PDB Description: the complex structure of extracellular domain of egfr and gc1118a

PDB Compounds: (L:) gc1118a

SCOPe Domain Sequences for d4uv7l1:

Sequence; same for both SEQRES and ATOM records:

>d4uv7l1 b.1.1.0 (L:1-112) automated matches {Homo sapiens [TaxId: 9606]}
divmtqtplslpvtpgepasiscrsnqdlthsngntylewylqkpgqsprlliykvsnrf
sgvpdrfsgsgagtdftlrisrveaedvgvyycmqgthwpwtfgqgtkvdik

Timeline for d4uv7l1:

• d4uv7l1 is new in SCOPe 2.05-stable
  
• d4uv7l1 appears in SCOPe 2.06
  
• d4uv7l1 appears in the current release, SCOPe 2.08