Lineage for d1bzm__ (1bzm -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) 
Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (7 PDB entries) 
Domain d1bzm__: 1bzm - [27817]
Details for d1bzm__
PDB Entry: 1bzm (more details), 2 Å
PDB Description: drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
SCOP Domain Sequences for d1bzm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzm__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
mqhnnrptqplkgrtvrasf
SCOP Domain Coordinates for d1bzm__:
Click to download the PDB-style file with coordinates for d1bzm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzm__:
- d1bzm__ appears in SCOP 1.57
- d1bzm__ appears in the current release, SCOPe 2.08, called d1bzma_
View in 3D