SCOPe 2.08: Domain d4rwta2: 4rwt A:147-375

Lineage for d4rwta2 (4rwt A:147-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)

8. Domain d4rwta2: 4rwt A:147-375 [278145]
   Other proteins in same PDB: d4rwta1, d4rwtb1, d4rwtc_
   automated match to d3ub5a2
   complexed with anp, mg

Details for d4rwta2

PDB Entry: 4rwt, 2.98 Å

PDB Description: structure of actin-lmod complex

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d4rwta2:

Sequence; same for both SEQRES and ATOM records:

>d4rwta2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdiredlyantvlsggttmypgiadrmqkeitalakstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d4rwta2:

• d4rwta2 first appeared in SCOPe 2.05
  
• d4rwta2 appears in SCOPe 2.07