Lineage for d1hcba_ (1hcb A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1328744Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 1328745Domain d1hcba_: 1hcb A: [27814]
    complexed with bct, zn

Details for d1hcba_

PDB Entry: 1hcb (more details), 1.6 Å

PDB Description: enzyme-substrate interactions: structure of human carbonic anhydrase i complexed with bicarbonate
PDB Compounds: (A:) carbonic anhydrase I

SCOPe Domain Sequences for d1hcba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf

SCOPe Domain Coordinates for d1hcba_:

Click to download the PDB-style file with coordinates for d1hcba_.
(The format of our PDB-style files is described here.)

Timeline for d1hcba_: