Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries) |
Domain d4p5mg2: 4p5m G:84-180 [278139] Other proteins in same PDB: d4p5mc1, d4p5me1, d4p5mg1 automated match to d1muja1 complexed with bma, na, nag |
PDB Entry: 4p5m (more details), 1.7 Å
SCOPe Domain Sequences for d4p5mg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p5mg2 b.1.1.0 (G:84-180) automated matches {Homo sapiens [TaxId: 9606]} ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy sfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
Timeline for d4p5mg2:
View in 3D Domains from other chains: (mouse over for more information) d4p5mc1, d4p5mc2, d4p5me1, d4p5me2 |