SCOPe 2.08: Domain d4p5mc2: 4p5m C:84-180

Lineage for d4p5mc2 (4p5m C:84-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4p5mc2: 4p5m C:84-180 [278136]
   Other proteins in same PDB: d4p5ma1, d4p5mc1, d4p5me1, d4p5mg1
   automated match to d1muja1
   complexed with na, nag

Details for d4p5mc2

PDB Entry: 4p5m, 1.7 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity

PDB Compounds: (C:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p5mc2:

Sequence; same for both SEQRES and ATOM records:

>d4p5mc2 b.1.1.0 (C:84-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy
sfhkfhyltfvpsaedfydcrvehwgldqpllkhwea

Timeline for d4p5mc2:

• d4p5mc2 first appeared in SCOPe 2.05
  
• d4p5mc2 appears in SCOPe 2.07