Lineage for d4p5me1 (4p5m E:1-83)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898187Domain d4p5me1: 4p5m E:1-83 [278135]
    Other proteins in same PDB: d4p5mc2, d4p5me2, d4p5mg2
    automated match to d1muja2
    complexed with bma, na, nag

Details for d4p5me1

PDB Entry: 4p5m (more details), 1.7 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
PDB Compounds: (E:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p5me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p5me1 d.19.1.0 (E:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
aniailnnnlntliqrsnhtqat

SCOPe Domain Coordinates for d4p5me1:

Click to download the PDB-style file with coordinates for d4p5me1.
(The format of our PDB-style files is described here.)

Timeline for d4p5me1: