Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries) |
Domain d4p5me1: 4p5m E:1-83 [278135] Other proteins in same PDB: d4p5mc2, d4p5me2, d4p5mg2 automated match to d1muja2 complexed with bma, na, nag |
PDB Entry: 4p5m (more details), 1.7 Å
SCOPe Domain Sequences for d4p5me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p5me1 d.19.1.0 (E:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl aniailnnnlntliqrsnhtqat
Timeline for d4p5me1:
View in 3D Domains from other chains: (mouse over for more information) d4p5mc1, d4p5mc2, d4p5mg1, d4p5mg2 |