SCOPe 2.08: Domain d5e2fb_: 5e2f B:

Lineage for d5e2fb_ (5e2f B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [278114] (4 PDB entries)

8. Domain d5e2fb_: 5e2f B: [278121]
   automated match to d2iwca_
   complexed with ca, edo

Details for d5e2fb_

PDB Entry: 5e2f, 1.3 Å

PDB Description: crystal structure of beta-lactamase class d from bacillus subtilis

PDB Compounds: (B:) Beta-lactamase YbxI

SCOPe Domain Sequences for d5e2fb_:

Sequence; same for both SEQRES and ATOM records:

>d5e2fb_ e.3.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
hlnvskmnvddefkdtdgtfilhdlqkdqtfvynrkranqrqtpqstfkvvnaliglqvk
avrdeydvkrwdgvkrefeswnrdhtlgsamresaiwyyqalardigeermktwlhtlsy
gnedisggidqfwlqssltispleqetfleklakeelpfdkpvmkivkrmmiqeegdhyt
lygktgtrltdmglgwfvgfiktehgsyvfvtnvddsgtkaknitvdilkkyglits

Timeline for d5e2fb_:

• d5e2fb_ first appeared in SCOPe 2.05
  
• d5e2fb_ appears in SCOPe 2.07