Lineage for d5e0ad_ (5e0a D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924236Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1924237Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1924238Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1924299Protein automated matches [190549] (4 species)
    not a true protein
  7. 1924302Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (32 PDB entries)
  8. 1924430Domain d5e0ad_: 5e0a D: [278108]
    automated match to d1ycka1
    complexed with nag, tla

Details for d5e0ad_

PDB Entry: 5e0a (more details), 2.6 Å

PDB Description: crystal structure of the complex of camel peptidoglycan recognition protein (cpgrp-s) and n-acetylglucosamine at 2.6 a
PDB Compounds: (D:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d5e0ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0ad_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d5e0ad_:

Click to download the PDB-style file with coordinates for d5e0ad_.
(The format of our PDB-style files is described here.)

Timeline for d5e0ad_: