Lineage for d1e15a1 (1e15 A:447-498)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63149Fold b.72: WW domain-like [51044] (2 superfamilies)
  4. 63172Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 63173Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 63180Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 63181Species Serratia marcescens [TaxId:615] [51062] (5 PDB entries)
  8. 63184Domain d1e15a1: 1e15 A:447-498 [27810]
    Other proteins in same PDB: d1e15a2, d1e15a3, d1e15b2, d1e15b3

Details for d1e15a1

PDB Entry: 1e15 (more details), 1.9 Å

PDB Description: chitinase b from serratia marcescens

SCOP Domain Sequences for d1e15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e15a1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv

SCOP Domain Coordinates for d1e15a1:

Click to download the PDB-style file with coordinates for d1e15a1.
(The format of our PDB-style files is described here.)

Timeline for d1e15a1: