Lineage for d5dibb1 (5dib B:2-496)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909953Species Staphylococcus aureus [TaxId:1280] [225527] (6 PDB entries)
  8. 2909965Domain d5dibb1: 5dib B:2-496 [278091]
    automated match to d4qn2a_
    complexed with epe, na, nad; mutant

Details for d5dibb1

PDB Entry: 5dib (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) y450l point mutant from staphylococcus aureus in complex with nad+ and bme-modified cys289
PDB Compounds: (B:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d5dibb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dibb1 c.82.1.0 (B:2-496) automated matches {Staphylococcus aureus [TaxId: 1280]}
ellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafes
gewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfag
ladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmkp
seitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkhi
mknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqnsi
kdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkrp
drddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglaga
vfskdigkaqrvanklklgtvwindfhplfaqapwggykqsgigrelgkegleeylvskh
iltntnpqlvnwfsk

SCOPe Domain Coordinates for d5dibb1:

Click to download the PDB-style file with coordinates for d5dibb1.
(The format of our PDB-style files is described here.)

Timeline for d5dibb1: