SCOPe 2.05: Domain d5d71l1: 5d71 L:1-108

Lineage for d5d71l1 (5d71 L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5d71l1: 5d71 L:1-108 [278081]
   Other proteins in same PDB: d5d71a_
   automated match to d3s96d1
   complexed with peg, so4

Details for d5d71l1

PDB Entry: 5d71, 2.25 Å

PDB Description: crystal structure of mor04302, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf

PDB Compounds: (L:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5d71l1:

Sequence, based on SEQRES records:

>d5d71l1 b.1.1.0 (L:1-108) automated matches {Homo sapiens [TaxId: 9606]}
dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrpsgiperfs
gsnsgntatltisgtqaedeadyycsawgdkgmvfgggtkltvlgq

Sequence, based on observed residues (ATOM records):

>d5d71l1 b.1.1.0 (L:1-108) automated matches {Homo sapiens [TaxId: 9606]}
dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlvierfsgsnsgntat
ltisgtqaedeadyycsawgdkgmvfgggtkltvlgq

Timeline for d5d71l1:

• d5d71l1 is new in SCOPe 2.05-stable
  
• d5d71l1 appears in SCOPe 2.06
  
• d5d71l1 appears in the current release, SCOPe 2.08