Lineage for d5czkb2 (5czk B:182-273)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768693Species Clostridium perfringens [TaxId:195102] [267955] (2 PDB entries)
  8. 1768696Domain d5czkb2: 5czk B:182-273 [278075]
    Other proteins in same PDB: d5czka1, d5czka3, d5czkb1, d5czkb3
    automated match to d4jkmb2
    complexed with 57z

Details for d5czkb2

PDB Entry: 5czk (more details), 2.39 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d5czkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5czkb2 b.1.4.0 (B:182-273) automated matches {Clostridium perfringens [TaxId: 195102]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d5czkb2:

Click to download the PDB-style file with coordinates for d5czkb2.
(The format of our PDB-style files is described here.)

Timeline for d5czkb2: