Lineage for d5czkb2 (5czk B:182-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763212Domain d5czkb2: 5czk B:182-273 [278075]
    Other proteins in same PDB: d5czka1, d5czka3, d5czka4, d5czkb1, d5czkb3, d5czkb4
    automated match to d4jkmb2
    complexed with 57z

Details for d5czkb2

PDB Entry: 5czk (more details), 2.39 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d5czkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5czkb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d5czkb2:

Click to download the PDB-style file with coordinates for d5czkb2.
(The format of our PDB-style files is described here.)

Timeline for d5czkb2: