SCOPe 2.05: Domain d5c9gd_: 5c9g D:

Lineage for d5c9gd_ (5c9g D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries)

8. Domain d5c9gd_: 5c9g D: [278037]
   automated match to d4olqa_
   complexed with mlt, pg4

Details for d5c9gd_

PDB Entry: 5c9g, 2.1 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium

PDB Compounds: (D:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d5c9gd_:

Sequence; same for both SEQRES and ATOM records:

>d5c9gd_ c.14.1.0 (D:) automated matches {Hyphomonas neptunium [TaxId: 228405]}
gvdlgtenlyfqsmtlpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpd
vklilihggdagafaagadisefetiyatedaakasgqriaqaldaiensekpviaaieg
acvgggvslamaadlrvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgr
iftageakslglidrlvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetp
eaqslflngfanedfkegyrafldkrpakftyr

Timeline for d5c9gd_:

• d5c9gd_ is new in SCOPe 2.05-stable
  
• d5c9gd_ is called d5c9gd1 in SCOPe 2.06
  
• d5c9gd_ appears in the current release, SCOPe 2.08, called d5c9gd1