Lineage for d4zo0c_ (4zo0 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917084Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1917085Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1917132Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 1917144Protein automated matches [277252] (2 species)
    not a true protein
  7. 1917145Species Adeno-associated virus 2 (isolate srivastava/1982) [TaxId:648242] [277998] (1 PDB entry)
  8. 1917148Domain d4zo0c_: 4zo0 C: [278001]
    automated match to d1uuta_
    complexed with ipa, mg

Details for d4zo0c_

PDB Entry: 4zo0 (more details), 2.3 Å

PDB Description: x-ray structure of aav-2 origin binding domain
PDB Compounds: (C:) Protein Rep68

SCOPe Domain Sequences for d4zo0c_:

Sequence, based on SEQRES records: (download)

>d4zo0c_ d.89.1.3 (C:) automated matches {Adeno-associated virus 2 (isolate srivastava/1982) [TaxId: 648242]}
hmpgfyeivikvpsdldehlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaekl
qrdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqr
iyrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsac
lnlterkrlvaq

Sequence, based on observed residues (ATOM records): (download)

>d4zo0c_ d.89.1.3 (C:) automated matches {Adeno-associated virus 2 (isolate srivastava/1982) [TaxId: 648242]}
hmpgfyeivikvpsdldehlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaekl
qrdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqr
iyrgieptlpnwfavtktrnagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaq

SCOPe Domain Coordinates for d4zo0c_:

Click to download the PDB-style file with coordinates for d4zo0c_.
(The format of our PDB-style files is described here.)

Timeline for d4zo0c_: