SCOPe 2.08: Domain d4xl3b2: 4xl3 B:270-392

Lineage for d4xl3b2 (4xl3 B:270-392)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:863638] [260180] (4 PDB entries)

8. Domain d4xl3b2: 4xl3 B:270-392 [277985]
   Other proteins in same PDB: d4xl3a3, d4xl3b3
   automated match to d4n46b2
   complexed with gol

Details for d4xl3b2

PDB Entry: 4xl3, 1.7 Å

PDB Description: crystal structure of reduced form of thiolase from clostridium acetobutylicum

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4xl3b2:

Sequence; same for both SEQRES and ATOM records:

>d4xl3b2 c.95.1.0 (B:270-392) automated matches {Clostridium acetobutylicum [TaxId: 863638]}
kplakivsygsagvdpaimgygpfyatkaaiekagwtvdeldliesneafaaqslavakd
lkfdmnkvnvnggaialghpigasgarilvtlvhamqkrdakkglatlsigggqgtaill
ekc

Timeline for d4xl3b2:

• d4xl3b2 first appeared in SCOPe 2.05
  
• d4xl3b2 appears in SCOPe 2.07