SCOPe 2.06: Domain d4xl2b1: 4xl2 B:1-269

Lineage for d4xl2b1 (4xl2 B:1-269)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:272562] [277964] (2 PDB entries)

8. Domain d4xl2b1: 4xl2 B:1-269 [277982]
   Other proteins in same PDB: d4xl2a3, d4xl2b3
   automated match to d4n46b1
   complexed with act, gol, peg

Details for d4xl2b1

PDB Entry: 4xl2, 1.77 Å

PDB Description: crystal structure of oxidized form of thiolase from clostridium acetobutylicum

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4xl2b1:

Sequence; same for both SEQRES and ATOM records:

>d4xl2b1 c.95.1.0 (B:1-269) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
vtagnasglndcaavlvimsaekakelgv

Timeline for d4xl2b1:

• d4xl2b1 first appeared in SCOPe 2.05
  
• d4xl2b1 appears in SCOPe 2.07
  
• d4xl2b1 appears in the current release, SCOPe 2.08