SCOPe 2.05: Domain d4wkxa_: 4wkx A:

Lineage for d4wkxa_ (4wkx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
   Uniprot P00282

8. Domain d4wkxa_: 4wkx A: [277958]
   automated match to d1etja_
   complexed with cu, trs; mutant

Details for d4wkxa_

PDB Entry: 4wkx, 1.94 Å

PDB Description: reversible s-nitrosylation in an engineered mutant of pseudomonas aeruginosa azurin with red copper site

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d4wkxa_:

Sequence; same for both SEQRES and ATOM records:

>d4wkxa_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmgenwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
hkgtltlk

Timeline for d4wkxa_:

• d4wkxa_ is new in SCOPe 2.05-stable
  
• d4wkxa_ appears in SCOPe 2.06
  
• d4wkxa_ appears in the current release, SCOPe 2.08