Lineage for d4v1dd_ (4v1d D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743608Domain d4v1dd_: 4v1d D: [277955]
    Other proteins in same PDB: d4v1db1, d4v1db2, d4v1dc_, d4v1de1, d4v1de2
    automated match to d1dqlh_

Details for d4v1dd_

PDB Entry: 4v1d (more details), 3.1 Å

PDB Description: ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.
PDB Compounds: (D:) single chain antibody fragment ru1, heavy chain

SCOPe Domain Sequences for d4v1dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v1dd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvnlresggglvqpggslrlscaasgfsfgsygmhwvrqapgkglewvavisygggnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakdardcllcadwhfdlwgrgtlv
tvss

SCOPe Domain Coordinates for d4v1dd_:

Click to download the PDB-style file with coordinates for d4v1dd_.
(The format of our PDB-style files is described here.)

Timeline for d4v1dd_: