Lineage for d4v1dc_ (4v1d C:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582033Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2582034Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2582050Protein Scorpion toxin [57097] (17 species)
  7. 2582097Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (4 PDB entries)
  8. 2582103Domain d4v1dc_: 4v1d C: [277951]
    Other proteins in same PDB: d4v1da_, d4v1db_, d4v1dd_, d4v1de_
    automated match to d2ybri_

Details for d4v1dc_

PDB Entry: 4v1d (more details), 3.1 Å

PDB Description: ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.
PDB Compounds: (C:) beta-mammal toxin cn2

SCOPe Domain Sequences for d4v1dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v1dc_ g.3.7.1 (C:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]}
kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
pnkrcs

SCOPe Domain Coordinates for d4v1dc_:

Click to download the PDB-style file with coordinates for d4v1dc_.
(The format of our PDB-style files is described here.)

Timeline for d4v1dc_: