Lineage for d4ufaa_ (4ufa A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206207Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)
  8. 2206254Domain d4ufaa_: 4ufa A: [277946]
    automated match to d2c6fa_
    complexed with asp, cl, nag, p6g, peg, sac, zn

Details for d4ufaa_

PDB Entry: 4ufa (more details), 1.8 Å

PDB Description: crystal structure of the angiotensin-1 converting enzyme n- domain in complex with ac-sd
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d4ufaa_:

Sequence, based on SEQRES records: (download)

>d4ufaa_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnypeg

Sequence, based on observed residues (ATOM records): (download)

>d4ufaa_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
pdnypeg

SCOPe Domain Coordinates for d4ufaa_:

Click to download the PDB-style file with coordinates for d4ufaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ufaa_: