Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (20 species) not a true protein |
Species Escherichia coli [TaxId:83333] [277890] (6 PDB entries) |
Domain d4rxgd_: 4rxg D: [277904] automated match to d1l6wa_ complexed with 1pe, gol |
PDB Entry: 4rxg (more details), 2.15 Å
SCOPe Domain Sequences for d4rxgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rxgd_ c.1.10.1 (D:) automated matches {Escherichia coli [TaxId: 83333]} melyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaev mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
Timeline for d4rxgd_: