SCOPe 2.05: Domain d1gcya1: 1gcy A:358-418

Lineage for d1gcya1 (1gcy A:358-418)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries)

8. Domain d1gcya1: 1gcy A:358-418 [27788]
   Other proteins in same PDB: d1gcya2
   complexed with ca

Details for d1gcya1

PDB Entry: 1gcy, 1.6 Å

PDB Description: high resolution crystal structure of maltotetraose-forming exo-amylase

PDB Compounds: (A:) glucan 1,4-alpha-maltotetrahydrolase

SCOPe Domain Sequences for d1gcya1:

Sequence; same for both SEQRES and ATOM records:

>d1gcya1 b.71.1.1 (A:358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s

Timeline for d1gcya1:

• d1gcya1 first appeared (with stable ids) in SCOP 1.55
  
• d1gcya1 appears in SCOPe 2.04
  
• d1gcya1 appears in SCOPe 2.06
  
• d1gcya1 appears in the current release, SCOPe 2.08