Lineage for d2n54a_ (2n54 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929377Domain d2n54a_: 2n54 A: [277872]
    automated match to d1j9oa_

Details for d2n54a_

PDB Entry: 2n54 (more details)

PDB Description: solution structure of a disulfide stabilized xcl1 dimer
PDB Compounds: (A:) Lymphotactin

SCOPe Domain Sequences for d2n54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n54a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgsevsdkrtcvslttqrlpvsriktytitegslrcvifitkrglkvccdpqatwvrdvv
rsmdrk

SCOPe Domain Coordinates for d2n54a_:

Click to download the PDB-style file with coordinates for d2n54a_.
(The format of our PDB-style files is described here.)

Timeline for d2n54a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2n54b_