Lineage for d1bf2_2 (1bf2 638-750)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17391Protein Isoamylase [51036] (1 species)
  7. 17392Species Pseudomonas amyloderamosa [TaxId:32043] [51037] (1 PDB entry)
  8. 17393Domain d1bf2_2: 1bf2 638-750 [27787]
    Other proteins in same PDB: d1bf2_1, d1bf2_3

Details for d1bf2_2

PDB Entry: 1bf2 (more details), 2 Å

PDB Description: structure of pseudomonas isoamylase

SCOP Domain Sequences for d1bf2_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf2_2 b.71.1.1 (638-750) Isoamylase {Pseudomonas amyloderamosa}
ysgsqltwyqpsgavadsnywnntsnyaiayaingpslgdsnsiyvayngwsssvtftlp
appsgtqwyrvtdtcdwndgastfvapgsetliggagttygqcgqsllllisk

SCOP Domain Coordinates for d1bf2_2:

Click to download the PDB-style file with coordinates for d1bf2_2.
(The format of our PDB-style files is described here.)

Timeline for d1bf2_2: