SCOPe 2.08: Domain d1bf2a2: 1bf2 A:638-750

Lineage for d1bf2a2 (1bf2 A:638-750)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Isoamylase [51036] (1 species)

7. Species Pseudomonas amyloderamosa [TaxId:32043] [51037] (1 PDB entry)

8. Domain d1bf2a2: 1bf2 A:638-750 [27787]
   Other proteins in same PDB: d1bf2a1, d1bf2a3
   complexed with ca

Details for d1bf2a2

PDB Entry: 1bf2, 2 Å

PDB Description: structure of pseudomonas isoamylase

PDB Compounds: (A:) isoamylase

SCOPe Domain Sequences for d1bf2a2:

Sequence; same for both SEQRES and ATOM records:

>d1bf2a2 b.71.1.1 (A:638-750) Isoamylase {Pseudomonas amyloderamosa [TaxId: 32043]}
ysgsqltwyqpsgavadsnywnntsnyaiayaingpslgdsnsiyvayngwsssvtftlp
appsgtqwyrvtdtcdwndgastfvapgsetliggagttygqcgqsllllisk

Timeline for d1bf2a2:

• d1bf2a2 first appeared (with stable ids) in SCOP 1.55, called d1bf2_2
  
• d1bf2a2 appears in SCOPe 2.07