SCOPe 2.08: Domain d5dzsa1: 5dzs A:1-100

Lineage for d5dzsa1 (5dzs A:1-100)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Peptoclostridium difficile [TaxId:272563] [277863] (1 PDB entry)

8. Domain d5dzsa1: 5dzs A:1-100 [277865]
   Other proteins in same PDB: d5dzsa2, d5dzsa3, d5dzsb2, d5dzsb3
   automated match to d2hk9a1
   complexed with so4

Details for d5dzsa1

PDB Entry: 5dzs, 1.5 Å

PDB Description: 1.5 angstrom crystal structure of shikimate dehydrogenase 1 from peptoclostridium difficile.

PDB Compounds: (A:) Shikimate dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5dzsa1:

Sequence; same for both SEQRES and ATOM records:

>d5dzsa1 c.58.1.0 (A:1-100) automated matches {Peptoclostridium difficile [TaxId: 272563]}
mnffglvgeklshsvspqihkrvfeilniesayknfeiskediskldgaikllgiqgvnv
tvpykerimkyldfispeakrigavntillrenmlygynt

Timeline for d5dzsa1:

• d5dzsa1 first appeared in SCOPe 2.05
  
• d5dzsa1 appears in SCOPe 2.07