Lineage for d5dela_ (5del A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1817085Protein automated matches [190228] (15 species)
    not a true protein
  7. 1817133Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256645] (8 PDB entries)
  8. 1817137Domain d5dela_: 5del A: [277859]
    automated match to d4cq8a_
    complexed with d59, fmn, gol, lda, oro

Details for d5dela_

PDB Entry: 5del (more details), 2.2 Å

PDB Description: crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm59
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone), mitochondrial

SCOPe Domain Sequences for d5dela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dela_ c.1.4.1 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
npefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinpf
gvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnnm
gcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyiai
nvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvkla
pdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkfice
mynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhlly
qrgyynlkeaigrk

SCOPe Domain Coordinates for d5dela_:

Click to download the PDB-style file with coordinates for d5dela_.
(The format of our PDB-style files is described here.)

Timeline for d5dela_: