Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries) |
Domain d1eh9a2: 1eh9 A:491-557 [27785] Other proteins in same PDB: d1eh9a1, d1eh9a3 |
PDB Entry: 1eh9 (more details), 3 Å
SCOPe Domain Sequences for d1eh9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh9a2 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]} cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd kgfalyk
Timeline for d1eh9a2: