Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [277843] (1 PDB entry) |
Domain d5cdfe2: 5cdf E:77-353 [277844] Other proteins in same PDB: d5cdfa1, d5cdfa3, d5cdfe1, d5cdfe3 automated match to d4q4la2 complexed with gol, po4 |
PDB Entry: 5cdf (more details), 2.3 Å
SCOPe Domain Sequences for d5cdfe2:
Sequence, based on SEQRES records: (download)
>d5cdfe2 c.37.1.0 (E:77-353) automated matches {Paracoccus denitrificans [TaxId: 266]} imvpvgdatlgrilnvvgepvdeggpveatqtraihqqapdfaaqataseilvtgikvid llapyskggkiglfggagvgktvlimelinniakvhsgysvfagvgertregndlyhemv esgvikpddlsksqvalvygqmneppgarmrvaltgltvaeqfrdatgtdvlffvdnifr ftqagsevsallgripsavgyqptlatdmgamqeritstkngsitsiqavyvpaddltdp apattfahldattvlsraiselgiypavdpldsnsri
>d5cdfe2 c.37.1.0 (E:77-353) automated matches {Paracoccus denitrificans [TaxId: 266]} imvpvgdatlgrilnvvgepvdeggpveatqtraihqqapdfaaqataseilvtgikvid llapyskggkiglfggagvgktvlimelinniakvhsgysvfagvgertregndlyhemv esgvikpddlsksqvalvygqmneppgarmrvaltgltvaeqfrdatgtdvlffvdnifr ftqagsevsallgripsptlatdmgamqeritstkngsitsiqavyvpaddltttfahld attvlsraiselgiypavdpldsnsri
Timeline for d5cdfe2: