Class b: All beta proteins [48724] (149 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries) |
Domain d1bvzb2: 1bvz B:503-585 [27784] Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3 |
PDB Entry: 1bvz (more details), 2.6 Å
SCOP Domain Sequences for d1bvzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvzb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1bvzb2: