SCOPe 2.05: Domain d5bzza1: 5bzz A:14-187

Lineage for d5bzza1 (5bzz A:14-187)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (10 PDB entries)

8. Domain d5bzza1: 5bzz A:14-187 [277829]
   Other proteins in same PDB: d5bzza2, d5bzzb2, d5bzzc2, d5bzzd2
   automated match to d1d5ra2
   complexed with tla

Details for d5bzza1

PDB Entry: 5bzz, 2.2 Å

PDB Description: crystal structure of human phosphatase pten in its reduced state

PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

SCOPe Domain Sequences for d5bzza1:

Sequence; same for both SEQRES and ATOM records:

>d5bzza1 c.45.1.1 (A:14-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld

Timeline for d5bzza1:

• d5bzza1 is new in SCOPe 2.05-stable
  
• d5bzza1 appears in SCOPe 2.06
  
• d5bzza1 appears in the current release, SCOPe 2.08