SCOPe 2.05: Domain d5bzxc2: 5bzx C:188-351

Lineage for d5bzxc2 (5bzx C:188-351)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein automated matches [190564] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries)

8. Domain d5bzxc2: 5bzx C:188-351 [277828]
   Other proteins in same PDB: d5bzxa1, d5bzxb1, d5bzxc1, d5bzxd1
   automated match to d1d5ra1
   complexed with tla, vo4

Details for d5bzxc2

PDB Entry: 5bzx, 2.5 Å

PDB Description: crystal structure of human phosphatase pten treated with a bisperoxovanadium complex

PDB Compounds: (C:) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

SCOPe Domain Sequences for d5bzxc2:

Sequence; same for both SEQRES and ATOM records:

>d5bzxc2 b.7.1.1 (C:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd
kanryfspnfkvklyftktv

Timeline for d5bzxc2:

• d5bzxc2 is new in SCOPe 2.05-stable
  
• d5bzxc2 appears in SCOPe 2.06
  
• d5bzxc2 appears in the current release, SCOPe 2.08