Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein automated matches [190564] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries) |
Domain d5bzxb2: 5bzx B:188-351 [277822] Other proteins in same PDB: d5bzxa1, d5bzxb1, d5bzxc1, d5bzxd1 automated match to d1d5ra1 complexed with tla, vo4 |
PDB Entry: 5bzx (more details), 2.5 Å
SCOPe Domain Sequences for d5bzxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bzxb2 b.7.1.1 (B:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]} yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd kanryfspnfkvklyftktv
Timeline for d5bzxb2: