Lineage for d1smab2 (1sma B:506-588)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17394Protein Maltogenic amylase [51031] (2 species)
  7. 17398Species Thermus sp. [TaxId:275] [51032] (1 PDB entry)
  8. 17400Domain d1smab2: 1sma B:506-588 [27782]
    Other proteins in same PDB: d1smaa1, d1smaa3, d1smab1, d1smab3

Details for d1smab2

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smab2 b.71.1.1 (B:506-588) Maltogenic amylase {Thermus sp.}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

SCOP Domain Coordinates for d1smab2:

Click to download the PDB-style file with coordinates for d1smab2.
(The format of our PDB-style files is described here.)

Timeline for d1smab2: