Lineage for d1smaa2 (1sma A:506-588)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63123Protein Maltogenic amylase [51031] (2 species)
  7. 63133Species Thermus sp. [TaxId:275] [51032] (1 PDB entry)
  8. 63134Domain d1smaa2: 1sma A:506-588 [27781]
    Other proteins in same PDB: d1smaa1, d1smaa3, d1smab1, d1smab3

Details for d1smaa2

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smaa2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp.}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

SCOP Domain Coordinates for d1smaa2:

Click to download the PDB-style file with coordinates for d1smaa2.
(The format of our PDB-style files is described here.)

Timeline for d1smaa2: