SCOPe 2.04: Domain d6taaa1: 6taa A:382-476

Lineage for d6taaa1 (6taa A:382-476)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)

8. Domain d6taaa1: 6taa A:382-476 [27779]
   Other proteins in same PDB: d6taaa2
   complexed with ca

Details for d6taaa1

PDB Entry: 6taa, 2.1 Å

PDB Description: structure and molecular model refinement of aspergillus oryzae (taka) alpha-amylase: an application of the simulated-annealing method

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6taaa1:

Sequence; same for both SEQRES and ATOM records:

>d6taaa1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

Timeline for d6taaa1:

• d6taaa1 first appeared (with stable ids) in SCOP 1.55, called d6taa_1
  
• d6taaa1 appears in SCOPe 2.03
  
• d6taaa1 appears in SCOPe 2.05
  
• d6taaa1 appears in the current release, SCOPe 2.08