Lineage for d6taa_1 (6taa 382-476)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Fungal alpha-amylase [51028] (2 species) Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (3 PDB entries) 
Domain d6taa_1: 6taa 382-476 [27779]
Other proteins in same PDB: d6taa_2
complexed with ca
Details for d6taa_1
PDB Entry: 6taa (more details), 2.1 Å
PDB Description: structure and molecular model refinement of aspergillus oryzae (taka) alpha-amylase: an application of the simulated-annealing method
SCOP Domain Sequences for d6taa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6taa_1 b.71.1.1 (382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics
SCOP Domain Coordinates for d6taa_1:
Click to download the PDB-style file with coordinates for d6taa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6taa_1:
- d6taa_1 first appeared (with stable ids) in SCOP 1.55
- d6taa_1 appears in SCOP 1.69
- d6taa_1 is called d6taaa1 in SCOP 1.73
- d6taa_1 appears in the current release, SCOPe 2.08, called d6taaa1
View in 3D
