Lineage for d4zlwf_ (4zlw F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729933Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries)
  8. 1729983Domain d4zlwf_: 4zlw F: [277774]
    automated match to d1z4aa_
    complexed with fe

Details for d4zlwf_

PDB Entry: 4zlw (more details), 2 Å

PDB Description: crystal structure of the pmftn variant e130a soaked in iron (overnight)
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d4zlwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zlwf_ a.25.1.0 (F:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]}
eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs

SCOPe Domain Coordinates for d4zlwf_:

Click to download the PDB-style file with coordinates for d4zlwf_.
(The format of our PDB-style files is described here.)

Timeline for d4zlwf_: