Lineage for d1viwa1 (1viw A:379-471)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1327924Protein Animal alpha-amylase [51024] (3 species)
  7. 1328001Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 1328005Domain d1viwa1: 1viw A:379-471 [27776]
    Other proteins in same PDB: d1viwa2, d1viwb_
    complexed with ca, cl

Details for d1viwa1

PDB Entry: 1viw (more details), 3 Å

PDB Description: tenebrio molitor alpha-amylase-inhibitor complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1viwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viwa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOPe Domain Coordinates for d1viwa1:

Click to download the PDB-style file with coordinates for d1viwa1.
(The format of our PDB-style files is described here.)

Timeline for d1viwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1viwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1viwb_