| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Animal alpha-amylase [51024] (3 species) |
| Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries) |
| Domain d1viwa1: 1viw A:379-471 [27776] Other proteins in same PDB: d1viwa2, d1viwb_ complexed with ca, cl |
PDB Entry: 1viw (more details), 3 Å
SCOPe Domain Sequences for d1viwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viwa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl
Timeline for d1viwa1: