Lineage for d1tmqa1 (1tmq A:379-471)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 170945Protein Animal alpha-amylase [51024] (3 species)
  7. 170981Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 170984Domain d1tmqa1: 1tmq A:379-471 [27775]
    Other proteins in same PDB: d1tmqa2, d1tmqb_

Details for d1tmqa1

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor

SCOP Domain Sequences for d1tmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOP Domain Coordinates for d1tmqa1:

Click to download the PDB-style file with coordinates for d1tmqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tmqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tmqb_