SCOPe 2.08: Domain d4zbdb2: 4zbd B:91-220

Lineage for d4zbdb2 (4zbd B:91-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d4zbdb2: 4zbd B:91-220 [277729]
   Other proteins in same PDB: d4zbda1, d4zbdb1
   automated match to d4ivfd2
   complexed with gsh

Details for d4zbdb2

PDB Entry: 4zbd, 1.12 Å

PDB Description: crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x- ray irradiation at 100k

PDB Compounds: (B:) PcUre2p6

SCOPe Domain Sequences for d4zbdb2:

Sequence; same for both SEQRES and ATOM records:

>d4zbdb2 a.45.1.0 (B:91-220) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vsvapgtneyytqlqwlyfqasgqgpyygqaawfsvyhpekvpsaieryrneikrvlgvl
esvlskqeflvdgkatvadfsflpwnegaakfllegsqfeeefpatakwhkkllerpaia
kvweerakvs

Timeline for d4zbdb2:

• d4zbdb2 first appeared in SCOPe 2.05
  
• d4zbdb2 appears in SCOPe 2.07