Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries) |
Domain d4zbdb2: 4zbd B:91-220 [277729] Other proteins in same PDB: d4zbda1, d4zbdb1 automated match to d4ivfd2 complexed with gsh |
PDB Entry: 4zbd (more details), 1.12 Å
SCOPe Domain Sequences for d4zbdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbdb2 a.45.1.0 (B:91-220) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]} vsvapgtneyytqlqwlyfqasgqgpyygqaawfsvyhpekvpsaieryrneikrvlgvl esvlskqeflvdgkatvadfsflpwnegaakfllegsqfeeefpatakwhkkllerpaia kvweerakvs
Timeline for d4zbdb2: