SCOPe 2.08: Domain d4zb7d1: 4zb7 D:4-90

Lineage for d4zb7d1 (4zb7 D:4-90)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)

8. Domain d4zb7d1: 4zb7 D:4-90 [277725]
   automated match to d4ivfa1
   complexed with gol, so4

Details for d4zb7d1

PDB Entry: 4zb7, 2.4 Å

PDB Description: phanerochaete chrysosporium ure2p6 in apo form.

PDB Compounds: (D:) PcUre2p6

SCOPe Domain Sequences for d4zb7d1:

Sequence, based on SEQRES records:

>d4zb7d1 c.47.1.0 (D:4-90) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifldfqkgehkapeylkvnpngripalid
hknndytvwesnaiiqylvdkydkdrk

Sequence, based on observed residues (ATOM records):

>d4zb7d1 c.47.1.0 (D:4-90) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifpngripalidhknndytvwesnaiiqy
lvdkydkdrk

Timeline for d4zb7d1:

• d4zb7d1 first appeared in SCOPe 2.05
  
• d4zb7d1 appears in SCOPe 2.07