Lineage for d4zbad2 (4zba D:96-223)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736451Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (8 PDB entries)
  8. 1736460Domain d4zbad2: 4zba D:96-223 [277698]
    Other proteins in same PDB: d4zbaa1, d4zbab1, d4zbac1, d4zbad1
    automated match to d1k0da1
    complexed with act, cl, gds

Details for d4zbad2

PDB Entry: 4zba (more details), 1.5 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium with oxidized glutathione.
PDB Compounds: (D:) PcUre2p8

SCOPe Domain Sequences for d4zbad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbad2 a.45.1.0 (D:96-223) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
pgtddfyiqlqwqyfqgtgqgpyfgqlvwftlyheekipsavtrykeealrvfsvlervl
snqewlvggkmtiadisfvswndmivhfldnfdfekefpataawhykmlkrptikrpwde
rrklmsrq

SCOPe Domain Coordinates for d4zbad2:

Click to download the PDB-style file with coordinates for d4zbad2.
(The format of our PDB-style files is described here.)

Timeline for d4zbad2: