Lineage for d4yjta_ (4yjt A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931488Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931489Species Human (Homo sapiens) [TaxId:9606] [118132] (52 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1931496Domain d4yjta_: 4yjt A: [277684]
    automated match to d3tuca_
    complexed with 4dq, gol

Details for d4yjta_

PDB Entry: 4yjt (more details), 1.52 Å

PDB Description: the kinase domain of human spleen tyrosine (syk) in complex with gtc000233
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4yjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yjta_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapec
inyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremyd
lmnlcwtydvenrpgfaavelrlrnyyydv

SCOPe Domain Coordinates for d4yjta_:

Click to download the PDB-style file with coordinates for d4yjta_.
(The format of our PDB-style files is described here.)

Timeline for d4yjta_: