SCOPe 2.08: Domain d4yg6d1: 4yg6 D:65-225

Lineage for d4yg6d1 (4yg6 D:65-225)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Rotavirus a [TaxId:10930] [277672] (2 PDB entries)

8. Domain d4yg6d1: 4yg6 D:65-225 [277677]
   Other proteins in same PDB: d4yg6a2, d4yg6b2, d4yg6c2, d4yg6d2
   automated match to d4drva_
   complexed with po4

Details for d4yg6d1

PDB Entry: 4yg6, 1.46 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses

PDB Compounds: (D:) Outer capsid protein VP8*

SCOPe Domain Sequences for d4yg6d1:

Sequence; same for both SEQRES and ATOM records:

>d4yg6d1 b.29.1.0 (D:65-225) automated matches {Rotavirus a [TaxId: 10930]}
ldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvmne
tvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadtqg
dlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl

Timeline for d4yg6d1:

• d4yg6d1 first appeared in SCOPe 2.05, called d4yg6d_
  
• d4yg6d1 appears in SCOPe 2.07