SCOPe 2.05: Domain d4yg6b_: 4yg6 B:

Lineage for d4yg6b_ (4yg6 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Rotavirus a [TaxId:10930] [277672] (2 PDB entries)

8. Domain d4yg6b_: 4yg6 B: [277676]
   automated match to d4drva_
   complexed with bgc, gal, nag, po4

Details for d4yg6b_

PDB Entry: 4yg6, 1.46 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses

PDB Compounds: (B:) Outer capsid protein VP8*

SCOPe Domain Sequences for d4yg6b_:

Sequence; same for both SEQRES and ATOM records:

>d4yg6b_ b.29.1.0 (B:) automated matches {Rotavirus a [TaxId: 10930]}
gsldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvm
netvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadt
qgdlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl

Timeline for d4yg6b_:

• d4yg6b_ is called d4yg6b1 in SCOPe 2.06
  
• d4yg6b_ appears in the current release, SCOPe 2.07, called d4yg6b1